Recombinant Human IGF1R/CD221 Protein

Artikelnummer: ABB-RP01143
Artikelname: Recombinant Human IGF1R/CD221 Protein
Artikelnummer: ABB-RP01143
Hersteller Artikelnummer: RP01143
Alternativnummer: ABB-RP01143-50UG
Hersteller: ABclonal
Wirt: Human
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Immunogen: Met1-Asn932
Alternative Synonym: IGF1R,CD221,IGFIR,IGFR,JTK13
Recombinant Human IGF1R/CD221 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Met1-Asn932) of human IGF1R (Accession NP_000866.1) fused with a 6*His tag at the C-terminus.
Konzentration: < 1 EU/µg of the protein by LAL method.
Molekulargewicht: 81 kDa(alpha chain), 23 kDa(beta chain) ,104 kDa(single chain)
Tag: C-His
NCBI: 3480
UniProt: P08069
Quelle: HEK293 cells
Reinheit: 90 % as determined by SDS-PAGE.
Formulierung: Lyophilized from a 0.22 µm filtered solution PBS Buffer, pH 7.4.Contact us for customized product form or formulation.
Sequenz: MKSGSGGGSPTSLWGLLFLSAALSLWPTSGEICGPGIDIRNDYQQLKRLENCTVIEGYLHILLISKAEDYRSYRFPKLTVITEYLLLFRVAGLESLGDLFPNLTVIRGWKLFYNYALVIFEMTNLKDIGLYNLRNITRGAIRIEKNADLCYLSTVDWSLILDAVSNNYIVGNKPPKECGDLCPGTMEEKPMCEKTTINNEYNYRCWTTNRCQKMCPSTCGKRACTENNECCHPECLGSCSAPDNDTACVACRHYY
Target-Kategorie: IGF1R/CD221
Application Verdünnung: Lyophilized from a 0.22 µm filtered solution PBS Buffer, pH 7.4.Contact us for customized product form or formulation.
Anwendungsbeschreibung: ResearchArea: Bio-Markers & CD Antigens,Growth Factor,Biosimilar Drug Targets. Shipping: Ice Bag
Recombinant Human IGF1R/CD221 Protein was determined by SDS-PAGE under reducing conditions with Coomassie Blue.