Recombinant Human IGF1R/CD221 Protein

Catalog Number: ABB-RP01143
Article Name: Recombinant Human IGF1R/CD221 Protein
Biozol Catalog Number: ABB-RP01143
Supplier Catalog Number: RP01143
Alternative Catalog Number: ABB-RP01143-50UG
Manufacturer: ABclonal
Host: Human
Category: Proteine/Peptide
Species Reactivity: Human
Immunogen: Met1-Asn932
Alternative Names: IGF1R,CD221,IGFIR,IGFR,JTK13
Recombinant Human IGF1R/CD221 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Met1-Asn932) of human IGF1R (Accession NP_000866.1) fused with a 6*His tag at the C-terminus.
Concentration: < 1 EU/µg of the protein by LAL method.
Molecular Weight: 81 kDa(alpha chain), 23 kDa(beta chain) ,104 kDa(single chain)
Tag: C-His
NCBI: 3480
UniProt: P08069
Source: HEK293 cells
Purity: 90 % as determined by SDS-PAGE.
Form: Lyophilized from a 0.22 µm filtered solution PBS Buffer, pH 7.4.Contact us for customized product form or formulation.
Sequence: MKSGSGGGSPTSLWGLLFLSAALSLWPTSGEICGPGIDIRNDYQQLKRLENCTVIEGYLHILLISKAEDYRSYRFPKLTVITEYLLLFRVAGLESLGDLFPNLTVIRGWKLFYNYALVIFEMTNLKDIGLYNLRNITRGAIRIEKNADLCYLSTVDWSLILDAVSNNYIVGNKPPKECGDLCPGTMEEKPMCEKTTINNEYNYRCWTTNRCQKMCPSTCGKRACTENNECCHPECLGSCSAPDNDTACVACRHYY
Target: IGF1R/CD221
Application Dilute: Lyophilized from a 0.22 µm filtered solution PBS Buffer, pH 7.4.Contact us for customized product form or formulation.
Application Notes: ResearchArea: Bio-Markers & CD Antigens,Growth Factor,Biosimilar Drug Targets. Shipping: Ice Bag
Recombinant Human IGF1R/CD221 Protein was determined by SDS-PAGE under reducing conditions with Coomassie Blue.