Recombinant TYRP1 Protein

Artikelnummer: ABB-RP01295
Artikelname: Recombinant TYRP1 Protein
Artikelnummer: ABB-RP01295
Hersteller Artikelnummer: RP01295
Alternativnummer: ABB-RP01295-50UG
Hersteller: ABclonal
Wirt: Human
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Immunogen: Met1-Arg471
Alternative Synonym: TRP, CAS2, CATB, GP75, OCA3, TRP1, TYRP, b-PROTEIN,TYRP1
Recombinant Human TRP1 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Met 1- Arg 471) of human TRP1 fused with a polyhistidine tag at the C-terminus.
Konzentration: < 1 EU/µg of the protein by LAL method.
Molekulargewicht: 52.2 kDa
Tag: C-His
NCBI: 7306
UniProt: P17643
Quelle: HEK293 cells
Reinheit: 95 % as determined by SDS-PAGE.
Formulierung: Lyophilized from sterile PBS, pH 7.4
Sequenz: MSAPKLLSLGCIFFPLLLFQQARAQFPRQCATVEALRSGMCCPDLSPVSGPGTDRCGSSSGRGRCEAVTADSRPHSPQYPHDGRDDREVWPLRFFNRTCHCNGNFSGHNCGTCRPGWRGAACDQRVLIVRRNLLDLSKEEKNHFVRALDMAKRTTHPLFVIATRRSEEILGPDGNTPQFENISIYNYFVWTHYYSVKKTFLGVGQESFGEVDFSHEGPAFLTWHRYHLLRLEKDMQEMLQEPSFSLPYWNFATGK
Target-Kategorie: TRP1
Application Verdünnung: Lyophilized from sterile PBS, pH 7.4
Anwendungsbeschreibung: ResearchArea: Other Recombinant Protein. Shipping: Ice Bag
Recombinant TRP1 Protein was determined by SDS-PAGE under reducing conditions with Coomassie Blue.