Recombinant TYRP1 Protein

Catalog Number: ABB-RP01295
Article Name: Recombinant TYRP1 Protein
Biozol Catalog Number: ABB-RP01295
Supplier Catalog Number: RP01295
Alternative Catalog Number: ABB-RP01295-50UG
Manufacturer: ABclonal
Host: Human
Category: Proteine/Peptide
Species Reactivity: Human
Immunogen: Met1-Arg471
Alternative Names: TRP, CAS2, CATB, GP75, OCA3, TRP1, TYRP, b-PROTEIN,TYRP1
Recombinant Human TRP1 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Met 1- Arg 471) of human TRP1 fused with a polyhistidine tag at the C-terminus.
Concentration: < 1 EU/µg of the protein by LAL method.
Molecular Weight: 52.2 kDa
Tag: C-His
NCBI: 7306
UniProt: P17643
Source: HEK293 cells
Purity: 95 % as determined by SDS-PAGE.
Form: Lyophilized from sterile PBS, pH 7.4
Sequence: MSAPKLLSLGCIFFPLLLFQQARAQFPRQCATVEALRSGMCCPDLSPVSGPGTDRCGSSSGRGRCEAVTADSRPHSPQYPHDGRDDREVWPLRFFNRTCHCNGNFSGHNCGTCRPGWRGAACDQRVLIVRRNLLDLSKEEKNHFVRALDMAKRTTHPLFVIATRRSEEILGPDGNTPQFENISIYNYFVWTHYYSVKKTFLGVGQESFGEVDFSHEGPAFLTWHRYHLLRLEKDMQEMLQEPSFSLPYWNFATGK
Target: TRP1
Application Dilute: Lyophilized from sterile PBS, pH 7.4
Application Notes: ResearchArea: Other Recombinant Protein. Shipping: Ice Bag
Recombinant TRP1 Protein was determined by SDS-PAGE under reducing conditions with Coomassie Blue.