Recombinant Human Cathepsin L Protein

Artikelnummer: ABB-RP02825
Artikelname: Recombinant Human Cathepsin L Protein
Artikelnummer: ABB-RP02825
Hersteller Artikelnummer: RP02825
Alternativnummer: ABB-RP02825-50UG
Hersteller: ABclonal
Wirt: Human
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Immunogen: Thr18-Val333
Alternative Synonym: Procathepsin L, 3.4.22.15, Cathepsin L1, Major excreted protein, MEP,CTSL
Recombinant Human Cathepsin L Protein is produced by HEK293 Cells expression system. The target protein is expressed with sequence (Thr18-Val333) of human Cathepsin L (Accession NP_001903.1) fused with a 6*His tag at the C-terminus.
Konzentration: < 1 EU/µg of the protein by LAL method.
Molekulargewicht: 37.3 kDa
Tag: C-His
NCBI: 1514
UniProt: P07711
Quelle: HEK293 Cells
Reinheit: 90 % as determined by SDS-PAGE.
Formulierung: Lyophilized from a 0.22 µm filtered solution of 50 mM NaAc, 100 mM NaCl, pH 7.5.
Sequenz: TLTFDHSLEAQWTKWKAMHNRLYGMNEEGWRRAVWEKNMKMIELHNQEYREGKHSFTMAMNAFGDMTSEEFRQVMNGFQNRKPRKGKVFQEPLFYEAPRSVDWREKGYVTPVKNQGQCGSCWAFSATGALEGQMFRKTGRLISLSEQNLVDCSGPQGNEGCNGGLMDYAFQYVQDNGGLDSEESYPYEATEESCKYNPKYSVANDTGFVDIPKQEKALMKAVATVGPISVAIDAGHESFLFYKEGIYFEPDCSSE
Target-Kategorie: Cathepsin L
Application Verdünnung: Lyophilized from a 0.22 µm filtered solution of 50 mM NaAc, 100 mM NaCl, pH 7.5.
Anwendungsbeschreibung: ResearchArea: Other Recombinant Protein. Shipping: Ice Bag
Recombinant Human Cathepsin L Protein was determined by SDS-PAGE under reducing conditions with Coomassie Blue.