Recombinant Human Cathepsin L Protein

Catalog Number: ABB-RP02825
Article Name: Recombinant Human Cathepsin L Protein
Biozol Catalog Number: ABB-RP02825
Supplier Catalog Number: RP02825
Alternative Catalog Number: ABB-RP02825-50UG
Manufacturer: ABclonal
Host: Human
Category: Proteine/Peptide
Species Reactivity: Human
Immunogen: Thr18-Val333
Alternative Names: Procathepsin L, 3.4.22.15, Cathepsin L1, Major excreted protein, MEP,CTSL
Recombinant Human Cathepsin L Protein is produced by HEK293 Cells expression system. The target protein is expressed with sequence (Thr18-Val333) of human Cathepsin L (Accession NP_001903.1) fused with a 6*His tag at the C-terminus.
Concentration: < 1 EU/µg of the protein by LAL method.
Molecular Weight: 37.3 kDa
Tag: C-His
NCBI: 1514
UniProt: P07711
Source: HEK293 Cells
Purity: 90 % as determined by SDS-PAGE.
Form: Lyophilized from a 0.22 µm filtered solution of 50 mM NaAc, 100 mM NaCl, pH 7.5.
Sequence: TLTFDHSLEAQWTKWKAMHNRLYGMNEEGWRRAVWEKNMKMIELHNQEYREGKHSFTMAMNAFGDMTSEEFRQVMNGFQNRKPRKGKVFQEPLFYEAPRSVDWREKGYVTPVKNQGQCGSCWAFSATGALEGQMFRKTGRLISLSEQNLVDCSGPQGNEGCNGGLMDYAFQYVQDNGGLDSEESYPYEATEESCKYNPKYSVANDTGFVDIPKQEKALMKAVATVGPISVAIDAGHESFLFYKEGIYFEPDCSSE
Target: Cathepsin L
Application Dilute: Lyophilized from a 0.22 µm filtered solution of 50 mM NaAc, 100 mM NaCl, pH 7.5.
Application Notes: ResearchArea: Other Recombinant Protein. Shipping: Ice Bag
Recombinant Human Cathepsin L Protein was determined by SDS-PAGE under reducing conditions with Coomassie Blue.