Recombinant Human MME/Neprilysin/CD10 Protein

Artikelnummer: ABB-RP02826
Artikelname: Recombinant Human MME/Neprilysin/CD10 Protein
Artikelnummer: ABB-RP02826
Hersteller Artikelnummer: RP02826
Alternativnummer: ABB-RP02826-50UG
Hersteller: ABclonal
Wirt: Human
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Immunogen: Tyr52-Trp750
Alternative Synonym: MME, EPN
Recombinant Human MME/CD10 Protein is produced by HEK293 Cells expression system. The target protein is expressed with sequence (Tyr52-Trp750) of human MME/CD10 (Accession NP_000893.2) fused with His tag at the N-terminus.
Konzentration: < 1 EU/µg of the protein by LAL method.
Molekulargewicht: 82.2 kDa
Tag: N-His
NCBI: 4311
UniProt: P08473
Quelle: HEK293 Cells
Reinheit: 95 % as determined by SDS-PAGE.
Formulierung: Lyophilized from a 0.22 µm filtered solution of 20mM MES, 100mM NaCl, 1mM ZnCl2, 10%glycerol, pH 6.5.
Sequenz: YDDGICKSSDCIKSAARLIQNMDATTEPCTDFFKYACGGWLKRNVIPETSSRYGNFDILRDELEVVLKDVLQEPKTEDIVAVQKAKALYRSCINESAIDSRGGEPLLKLLPDIYGWPVATENWEQKYGASWTAEKAIAQLNSKYGKKVLINLFVGTDDKNSVNHVIHIDQPRLGLPSRDYYECTGIYKEACTAYVDFMISVARLIRQEERLPIDENQLALEMNKVMELEKEIANATAKPEDRNDPMLLYNKMTLA
Target-Kategorie: CD10/MME
Application Verdünnung: Lyophilized from a 0.22 µm filtered solution of 20mM MES, 100mM NaCl, 1mM ZnCl2, 10%glycerol, pH 6.5.
Anwendungsbeschreibung: ResearchArea: Other Recombinant Protein. Shipping: Ice Bag
Recombinant Human MME/CD10 Protein was determined by SDS-PAGE under reducing conditions with Coomassie Blue.