Recombinant Human MME/Neprilysin/CD10 Protein

Catalog Number: ABB-RP02826
Article Name: Recombinant Human MME/Neprilysin/CD10 Protein
Biozol Catalog Number: ABB-RP02826
Supplier Catalog Number: RP02826
Alternative Catalog Number: ABB-RP02826-50UG
Manufacturer: ABclonal
Host: Human
Category: Proteine/Peptide
Species Reactivity: Human
Immunogen: Tyr52-Trp750
Alternative Names: MME, EPN
Recombinant Human MME/CD10 Protein is produced by HEK293 Cells expression system. The target protein is expressed with sequence (Tyr52-Trp750) of human MME/CD10 (Accession NP_000893.2) fused with His tag at the N-terminus.
Concentration: < 1 EU/µg of the protein by LAL method.
Molecular Weight: 82.2 kDa
Tag: N-His
NCBI: 4311
UniProt: P08473
Source: HEK293 Cells
Purity: 95 % as determined by SDS-PAGE.
Form: Lyophilized from a 0.22 µm filtered solution of 20mM MES, 100mM NaCl, 1mM ZnCl2, 10%glycerol, pH 6.5.
Sequence: YDDGICKSSDCIKSAARLIQNMDATTEPCTDFFKYACGGWLKRNVIPETSSRYGNFDILRDELEVVLKDVLQEPKTEDIVAVQKAKALYRSCINESAIDSRGGEPLLKLLPDIYGWPVATENWEQKYGASWTAEKAIAQLNSKYGKKVLINLFVGTDDKNSVNHVIHIDQPRLGLPSRDYYECTGIYKEACTAYVDFMISVARLIRQEERLPIDENQLALEMNKVMELEKEIANATAKPEDRNDPMLLYNKMTLA
Target: CD10/MME
Application Dilute: Lyophilized from a 0.22 µm filtered solution of 20mM MES, 100mM NaCl, 1mM ZnCl2, 10%glycerol, pH 6.5.
Application Notes: ResearchArea: Other Recombinant Protein. Shipping: Ice Bag
Recombinant Human MME/CD10 Protein was determined by SDS-PAGE under reducing conditions with Coomassie Blue.