Recombinant Human CXCL13/BLC Protein

Artikelnummer: ABB-RP02839
Artikelname: Recombinant Human CXCL13/BLC Protein
Artikelnummer: ABB-RP02839
Hersteller Artikelnummer: RP02839
Alternativnummer: ABB-RP02839-20UG,ABB-RP02839-100UG
Hersteller: ABclonal
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Immunogen: Val23-Arg94
Alternative Synonym: ANGIE, ANGIE2, BCA-1, BCA1, BLC, BLR1L, SCYB13,CXCL13
Recombinant Human CXCL13/BLC Protein is produced by E. coli expression system. The target protein is expressed with sequence (Val23-Arg94) of human CXCL13/BLC (Accession NP_006410.1) fused with no additional amino acid.
Konzentration: < 1 EU/µg of the protein by LAL method.
Molekulargewicht: 8.8 kDa
Tag: No tag
NCBI: 10563
UniProt: O43927
Quelle: E. coli
Reinheit: 95 % as determined by SDS-PAGE.
Formulierung: Lyophilized from a 0.22 µm filtered solution of 50 mM Tris, 0.5 M NaCl, pH 7.5.
Sequenz: VLEVYYTSLRCRCVQESSVFIPRRFIDRIQILPRGNGCPRKEIIVWKKNKSIVCVDPQAEWIQRMMEVLRKR
Target-Kategorie: CXCL13/BLC
Application Verdünnung: Lyophilized from a 0.22 µm filtered solution of 50 mM Tris, 0.5 M NaCl, pH 7.5.
Anwendungsbeschreibung: ResearchArea: Cytokines & Cytokine receptors. Shipping: Ice Bag
Recombinant Human CXCL13/BLC Protein was determined by SDS-PAGE under reducing conditions with Coomassie Blue.