Recombinant Human CXCL13/BLC Protein

Catalog Number: ABB-RP02839
Article Name: Recombinant Human CXCL13/BLC Protein
Biozol Catalog Number: ABB-RP02839
Supplier Catalog Number: RP02839
Alternative Catalog Number: ABB-RP02839-20UG,ABB-RP02839-100UG
Manufacturer: ABclonal
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Human
Immunogen: Val23-Arg94
Alternative Names: ANGIE, ANGIE2, BCA-1, BCA1, BLC, BLR1L, SCYB13,CXCL13
Recombinant Human CXCL13/BLC Protein is produced by E. coli expression system. The target protein is expressed with sequence (Val23-Arg94) of human CXCL13/BLC (Accession NP_006410.1) fused with no additional amino acid.
Concentration: < 1 EU/µg of the protein by LAL method.
Molecular Weight: 8.8 kDa
Tag: No tag
NCBI: 10563
UniProt: O43927
Source: E. coli
Purity: 95 % as determined by SDS-PAGE.
Form: Lyophilized from a 0.22 µm filtered solution of 50 mM Tris, 0.5 M NaCl, pH 7.5.
Sequence: VLEVYYTSLRCRCVQESSVFIPRRFIDRIQILPRGNGCPRKEIIVWKKNKSIVCVDPQAEWIQRMMEVLRKR
Target: CXCL13/BLC
Application Dilute: Lyophilized from a 0.22 µm filtered solution of 50 mM Tris, 0.5 M NaCl, pH 7.5.
Application Notes: ResearchArea: Cytokines & Cytokine receptors. Shipping: Ice Bag
Recombinant Human CXCL13/BLC Protein was determined by SDS-PAGE under reducing conditions with Coomassie Blue.