Recombinant Human PPAR gamma Protein

Artikelnummer: ABB-RP02853
Artikelname: Recombinant Human PPAR gamma Protein
Artikelnummer: ABB-RP02853
Hersteller Artikelnummer: RP02853
Alternativnummer: ABB-RP02853-50UG
Hersteller: ABclonal
Wirt: Virus
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Immunogen: Met1-Tyr505
Alternative Synonym: GLM1, CIMT1, NR1C3, PPARG1, PPARG2, PPARG5, PPARgamma,PPARG
Recombinant Human PPAR gamma Protein is produced by Baculovirus-Insect Cells expression system. The target protein is expressed with sequence (Met1-Tyr505) of human PPAR gamma (Accession NP_056953.2) fused with a His&GST tag at the N-terminus.
Konzentration: < 1 EU/µg of the protein by LAL method.
Molekulargewicht: 85.4 kDa
Tag: N-His&amp;GST
NCBI: 5468
UniProt: P37231
Quelle: Baculovirus-Insect Cells
Reinheit: 95 % as determined by SDS-PAGE.
Formulierung: Lyophilized from a 0.22 µm filtered solution of 50mM Tris, 100mM NaCl, pH 7.4, 20% gly, 0.3mM DTT.
Sequenz: MGETLGDSPIDPESDSFTDTLSANISQEMTMVDTEMPFWPTNFGISSVDLSVMEDHSHSFDIKPFTTVDFSSISTPHYEDIPFTRTDPVVADYKYDLKLQEYQSAIKVEPASPPYYSEKTQLYNKPHEEPSNSLMAIECRVCGDKASGFHYGVHACEGCKGFFRRTIRLKLIYDRCDLNCRIHKKSRNKCQYCRFQKCLAVGMSHNAIRFGRMPQAEKEKLLAEISSDIDQLNPESADLRALAKHLYDSYIKSFP
Target-Kategorie: PPAR gamma
Application Verdünnung: Lyophilized from a 0.22 µm filtered solution of 50mM Tris, 100mM NaCl, pH 7.4, 20% gly, 0.3mM DTT.
Anwendungsbeschreibung: ResearchArea: Other Recombinant Protein. Shipping: Ice Bag
Recombinant Human PPAR gamma Protein was determined by SDS-PAGE under reducing conditions with Coomassie Blue.