Recombinant Human PPAR gamma Protein

Catalog Number: ABB-RP02853
Article Name: Recombinant Human PPAR gamma Protein
Biozol Catalog Number: ABB-RP02853
Supplier Catalog Number: RP02853
Alternative Catalog Number: ABB-RP02853-50UG
Manufacturer: ABclonal
Host: Virus
Category: Proteine/Peptide
Species Reactivity: Human
Immunogen: Met1-Tyr505
Alternative Names: GLM1, CIMT1, NR1C3, PPARG1, PPARG2, PPARG5, PPARgamma,PPARG
Recombinant Human PPAR gamma Protein is produced by Baculovirus-Insect Cells expression system. The target protein is expressed with sequence (Met1-Tyr505) of human PPAR gamma (Accession NP_056953.2) fused with a His&GST tag at the N-terminus.
Concentration: < 1 EU/µg of the protein by LAL method.
Molecular Weight: 85.4 kDa
Tag: N-His&amp;GST
NCBI: 5468
UniProt: P37231
Source: Baculovirus-Insect Cells
Purity: 95 % as determined by SDS-PAGE.
Form: Lyophilized from a 0.22 µm filtered solution of 50mM Tris, 100mM NaCl, pH 7.4, 20% gly, 0.3mM DTT.
Sequence: MGETLGDSPIDPESDSFTDTLSANISQEMTMVDTEMPFWPTNFGISSVDLSVMEDHSHSFDIKPFTTVDFSSISTPHYEDIPFTRTDPVVADYKYDLKLQEYQSAIKVEPASPPYYSEKTQLYNKPHEEPSNSLMAIECRVCGDKASGFHYGVHACEGCKGFFRRTIRLKLIYDRCDLNCRIHKKSRNKCQYCRFQKCLAVGMSHNAIRFGRMPQAEKEKLLAEISSDIDQLNPESADLRALAKHLYDSYIKSFP
Target: PPAR gamma
Application Dilute: Lyophilized from a 0.22 µm filtered solution of 50mM Tris, 100mM NaCl, pH 7.4, 20% gly, 0.3mM DTT.
Application Notes: ResearchArea: Other Recombinant Protein. Shipping: Ice Bag
Recombinant Human PPAR gamma Protein was determined by SDS-PAGE under reducing conditions with Coomassie Blue.