Recombinant Human Aldehyde reductase/AKR1B1 Protein

Artikelnummer: ABB-RP02938
Artikelname: Recombinant Human Aldehyde reductase/AKR1B1 Protein
Artikelnummer: ABB-RP02938
Hersteller Artikelnummer: RP02938
Alternativnummer: ABB-RP02938-100UG
Hersteller: ABclonal
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Immunogen: Met1-Phe316
Alternative Synonym: AKR1B1, ADR, ALDR1, ALR2, AR, aldose reductase,ADR,ALDR1,ALR2,AR
Recombinant Human Aldehyde reductase/AKR1B1 Protein is produced by E. coli expression system. The target protein is expressed with sequence (Met1-Phe316) of human Aldehyde reductase/AKR1B1 (Accession NP_001619.1) fused with 6*His tag at the N-terminus.
Konzentration: Please contact us for more information.
Molekulargewicht: 37.9 kDa
Tag: N-His
NCBI: 231
UniProt: P15121
Quelle: E. coli
Reinheit: 90 % as determined by SDS-PAGE.
Formulierung: Lyophilized from a 0.22 µm filtered solution of PBS, 20% glycerol, pH 7.5.
Sequenz: MASRLLLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLREQVVKREELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPTGFKPGKEFFPLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHNKTTAQVLIRFPMQ
Target-Kategorie: Aldehyde reductase/AKR1B1
Application Verdünnung: Lyophilized from a 0.22 µm filtered solution of PBS, 20% glycerol, pH 7.5.
Anwendungsbeschreibung: ResearchArea: Other Recombinant Protein. Shipping: Ice Bag
Recombinant Human Aldehyde reductase/AKR1B1 Protein was determined by SDS-PAGE under reducing conditions with Coomassie Blue.