Recombinant Human Aldehyde reductase/AKR1B1 Protein

Catalog Number: ABB-RP02938
Article Name: Recombinant Human Aldehyde reductase/AKR1B1 Protein
Biozol Catalog Number: ABB-RP02938
Supplier Catalog Number: RP02938
Alternative Catalog Number: ABB-RP02938-100UG
Manufacturer: ABclonal
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Human
Immunogen: Met1-Phe316
Alternative Names: AKR1B1, ADR, ALDR1, ALR2, AR, aldose reductase,ADR,ALDR1,ALR2,AR
Recombinant Human Aldehyde reductase/AKR1B1 Protein is produced by E. coli expression system. The target protein is expressed with sequence (Met1-Phe316) of human Aldehyde reductase/AKR1B1 (Accession NP_001619.1) fused with 6*His tag at the N-terminus.
Concentration: Please contact us for more information.
Molecular Weight: 37.9 kDa
Tag: N-His
NCBI: 231
UniProt: P15121
Source: E. coli
Purity: 90 % as determined by SDS-PAGE.
Form: Lyophilized from a 0.22 µm filtered solution of PBS, 20% glycerol, pH 7.5.
Sequence: MASRLLLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLREQVVKREELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPTGFKPGKEFFPLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHNKTTAQVLIRFPMQ
Target: Aldehyde reductase/AKR1B1
Application Dilute: Lyophilized from a 0.22 µm filtered solution of PBS, 20% glycerol, pH 7.5.
Application Notes: ResearchArea: Other Recombinant Protein. Shipping: Ice Bag
Recombinant Human Aldehyde reductase/AKR1B1 Protein was determined by SDS-PAGE under reducing conditions with Coomassie Blue.