Recombinant Human Microfibrillar-associated protein 5 Protein

Artikelnummer: ABB-RP02966

Bilder (1)
Sehen Sie alle Bilder und Bildinformationen

Artikelname:	Recombinant Human Microfibrillar-associated protein 5 Protein
Artikelnummer:	ABB-RP02966
Hersteller Artikelnummer:	RP02966
Alternativnummer:	ABB-RP02966-100UG
Hersteller:	ABclonal
Wirt:	Human
Kategorie:	Proteine/Peptide
Spezies Reaktivität:	Human
Immunogen:	Met1-Leu173
Alternative Synonym:	AAT9 , MAGP-2 , MAGP2 , MFAP-5, MP25

Recombinant Human Microfibrillar-associated protein 5 Protein is produced by HEK293 Cells expression system. The target protein is expressed with sequence (Met1-Leu173) of human Microfibrillar-associated protein 5 (Accession NP_003471.1) fused with a 6*His tag at the C-terminus.

Konzentration:	< 1 EU/µg of the protein by LAL method.
Molekulargewicht:	18.7 kDa
Tag:	C-His
NCBI:	8076
UniProt:	Q13361
Quelle:	HEK293 Cells
Reinheit:	85 % as determined by SDS-PAGE.
Formulierung:	Lyophilized from sterile PBS, pH 7.4
Sequenz:	MSLLGPKVLLFLAAFIITSDWIPLGVNSQRGDDVTQATPETFTEDPNLVNDPATDETVLAVLADIAPSTDDLASLSEKNTTAECWDEKFTCTRLYSVHRPVKQCIHQLCFTSLRRMYIVNKEICSRLVCKEHEAMKDELCRQMAGLPPRRLRRSNYFRLPPCENVDLQRPNGL
Target-Kategorie:	Microfibrillar-associated protein 5

Application Verdünnung:	Lyophilized from sterile PBS, pH 7.4
Anwendungsbeschreibung:	ResearchArea: Other Recombinant Protein. Shipping: Ice Bag

Recombinant Human Microfibrillar-associated protein 5 Protein was determined by SDS-PAGE under reducing conditions with Coomassie Blue.

* Mehrwertsteuer und Versandkosten nicht enthalten.
Irrtümer und Preisänderungen vorbehalten