Recombinant Human Microfibrillar-associated protein 5 Protein

Catalog Number: ABB-RP02966
Article Name: Recombinant Human Microfibrillar-associated protein 5 Protein
Biozol Catalog Number: ABB-RP02966
Supplier Catalog Number: RP02966
Alternative Catalog Number: ABB-RP02966-100UG
Manufacturer: ABclonal
Host: Human
Category: Proteine/Peptide
Species Reactivity: Human
Immunogen: Met1-Leu173
Alternative Names: AAT9 , MAGP-2 , MAGP2 , MFAP-5, MP25
Recombinant Human Microfibrillar-associated protein 5 Protein is produced by HEK293 Cells expression system. The target protein is expressed with sequence (Met1-Leu173) of human Microfibrillar-associated protein 5 (Accession NP_003471.1) fused with a 6*His tag at the C-terminus.
Concentration: < 1 EU/µg of the protein by LAL method.
Molecular Weight: 18.7 kDa
Tag: C-His
NCBI: 8076
UniProt: Q13361
Source: HEK293 Cells
Purity: 85 % as determined by SDS-PAGE.
Form: Lyophilized from sterile PBS, pH 7.4
Sequence: MSLLGPKVLLFLAAFIITSDWIPLGVNSQRGDDVTQATPETFTEDPNLVNDPATDETVLAVLADIAPSTDDLASLSEKNTTAECWDEKFTCTRLYSVHRPVKQCIHQLCFTSLRRMYIVNKEICSRLVCKEHEAMKDELCRQMAGLPPRRLRRSNYFRLPPCENVDLQRPNGL
Target: Microfibrillar-associated protein 5
Application Dilute: Lyophilized from sterile PBS, pH 7.4
Application Notes: ResearchArea: Other Recombinant Protein. Shipping: Ice Bag
Recombinant Human Microfibrillar-associated protein 5 Protein was determined by SDS-PAGE under reducing conditions with Coomassie Blue.
611,00 €
100 µg
* VAT and and shipping costs not included.
Errors and price changes excepted
Availability
ORDER BY EMAIL
Product Guarantee and Expert Support
BIOZOL