Recombinant Human CISD1 Protein

Artikelnummer: ABB-RP02993
Artikelname: Recombinant Human CISD1 Protein
Artikelnummer: ABB-RP02993
Hersteller Artikelnummer: RP02993
Alternativnummer: ABB-RP02993-100UG
Hersteller: ABclonal
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Immunogen: Lys32-Thr108
Alternative Synonym: C10orf70, MDS029, mitoNEET, ZCD1
Recombinant Human CISD1 Protein is produced by E. coli expression system. The target protein is expressed with sequence (Lys32-Thr108) of human CISD1 (Accession NP_060934.1) fused with a 6*His tag at the N-terminus.
Konzentration: Please contact us for more information.
Molekulargewicht: 11.3 kDa
Tag: N-His
NCBI: 55847
UniProt: Q9NZ45
Quelle: E. coli
Reinheit: 90 % as determined by SDS-PAGE.
Formulierung: Lyophilized from a 0.22 µm filtered solution of 20 mM Tris, 150 mM NaCl, 10 % glycerol.
Sequenz: KRFYVKDHRNKAMINLHIQKDNPKIVHAFDMEDLGDKAVYCRCWRSKKFPFCDGAHTKHNEETGDNVGPLIIKKKET
Target-Kategorie: CISD1
Application Verdünnung: Lyophilized from a 0.22 µm filtered solution of 20 mM Tris, 150 mM NaCl, 10 % glycerol.
Anwendungsbeschreibung: ResearchArea: Other Recombinant Protein. Shipping: Ice Bag
Recombinant Human CISD1 Protein was determined by SDS-PAGE under reducing conditions with Coomassie Blue.