Recombinant Human CISD1 Protein

Catalog Number: ABB-RP02993
Article Name: Recombinant Human CISD1 Protein
Biozol Catalog Number: ABB-RP02993
Supplier Catalog Number: RP02993
Alternative Catalog Number: ABB-RP02993-100UG
Manufacturer: ABclonal
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Human
Immunogen: Lys32-Thr108
Alternative Names: C10orf70, MDS029, mitoNEET, ZCD1
Recombinant Human CISD1 Protein is produced by E. coli expression system. The target protein is expressed with sequence (Lys32-Thr108) of human CISD1 (Accession NP_060934.1) fused with a 6*His tag at the N-terminus.
Concentration: Please contact us for more information.
Molecular Weight: 11.3 kDa
Tag: N-His
NCBI: 55847
UniProt: Q9NZ45
Source: E. coli
Purity: 90 % as determined by SDS-PAGE.
Form: Lyophilized from a 0.22 µm filtered solution of 20 mM Tris, 150 mM NaCl, 10 % glycerol.
Sequence: KRFYVKDHRNKAMINLHIQKDNPKIVHAFDMEDLGDKAVYCRCWRSKKFPFCDGAHTKHNEETGDNVGPLIIKKKET
Target: CISD1
Application Dilute: Lyophilized from a 0.22 µm filtered solution of 20 mM Tris, 150 mM NaCl, 10 % glycerol.
Application Notes: ResearchArea: Other Recombinant Protein. Shipping: Ice Bag
Recombinant Human CISD1 Protein was determined by SDS-PAGE under reducing conditions with Coomassie Blue.