Recombinant Human EG-VEGF/PK1 Protein

Artikelnummer: ABB-RP03103
Artikelname: Recombinant Human EG-VEGF/PK1 Protein
Artikelnummer: ABB-RP03103
Hersteller Artikelnummer: RP03103
Alternativnummer: ABB-RP03103-50UG
Hersteller: ABclonal
Wirt: Virus
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Immunogen: Met1-Phe105
Alternative Synonym: EG-VEGF, PK1, PRK1
Recombinant Human Prokineticin-1/EG-VEGF Protein is produced by Baculovirus-Insect Cells expression system. The target protein is expressed with sequence (Met1-Phe105) of human Prokineticin-1/EG-VEGF (Accession NP_115790.1) fused with His tag at the C-terminus.
Konzentration: < 1 EU/µg of the protein by LAL method.
Molekulargewicht: 11kDa
Tag: C-His
NCBI: 84432
UniProt: P58294
Quelle: Baculovirus-Insect Cells
Reinheit: 90 % as determined by SDS-PAGE.
Formulierung: Lyophilized from a 0.22 µm filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.
Sequenz: MRGATRVSIMLLLVTVSDCAVITGACERDVQCGAGTCCAISLWLRGLRMCTPLGREGEECHPGSHKVPFFRKRKHHTCPCLPNLLCSRFPDGRYRCSMDLKNINF
Target-Kategorie: Prokineticin-1/EG-VEGF
Application Verdünnung: Lyophilized from a 0.22 µm filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.
Anwendungsbeschreibung: ResearchArea: Other Recombinant Protein. Shipping: Ice Bag
Recombinant Human EG-VEGF/PK1 Protein was determined by SDS-PAGE under reducing conditions with Coomassie Blue.