Recombinant Human EG-VEGF/PK1 Protein

Catalog Number: ABB-RP03103
Article Name: Recombinant Human EG-VEGF/PK1 Protein
Biozol Catalog Number: ABB-RP03103
Supplier Catalog Number: RP03103
Alternative Catalog Number: ABB-RP03103-50UG
Manufacturer: ABclonal
Host: Virus
Category: Proteine/Peptide
Species Reactivity: Human
Immunogen: Met1-Phe105
Alternative Names: EG-VEGF, PK1, PRK1
Recombinant Human Prokineticin-1/EG-VEGF Protein is produced by Baculovirus-Insect Cells expression system. The target protein is expressed with sequence (Met1-Phe105) of human Prokineticin-1/EG-VEGF (Accession NP_115790.1) fused with His tag at the C-terminus.
Concentration: < 1 EU/µg of the protein by LAL method.
Molecular Weight: 11kDa
Tag: C-His
NCBI: 84432
UniProt: P58294
Source: Baculovirus-Insect Cells
Purity: 90 % as determined by SDS-PAGE.
Form: Lyophilized from a 0.22 µm filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.
Sequence: MRGATRVSIMLLLVTVSDCAVITGACERDVQCGAGTCCAISLWLRGLRMCTPLGREGEECHPGSHKVPFFRKRKHHTCPCLPNLLCSRFPDGRYRCSMDLKNINF
Target: Prokineticin-1/EG-VEGF
Application Dilute: Lyophilized from a 0.22 µm filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.
Application Notes: ResearchArea: Other Recombinant Protein. Shipping: Ice Bag
Recombinant Human EG-VEGF/PK1 Protein was determined by SDS-PAGE under reducing conditions with Coomassie Blue.