Recombinant Human PCLAF Protein

Artikelnummer: ABB-RP03162
Artikelname: Recombinant Human PCLAF Protein
Artikelnummer: ABB-RP03162
Hersteller Artikelnummer: RP03162
Alternativnummer: ABB-RP03162-50UG
Hersteller: ABclonal
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Immunogen: Met1-Glu111
Alternative Synonym: PCLAF, KIAA0101, NS5ATP9, PAF
Recombinant Human PCLAF Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Met1-Glu111) of Human PCLAF (Accession NP_055551.1) fused with a polyhistide tag at the N-terminus.
Konzentration: Please contact us for more information.
Molekulargewicht: 13.8 KDa.
Tag: N-His
NCBI: 9768
UniProt: Q15004
Quelle: E. coli
Reinheit: 95 % as determined by SDS-PAGE.
Formulierung: Lyophilized from a 0.22 µm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.
Sequenz: MVRTKADSVPGTYRKVVAARAPRKVLGSSTSATNSTSVSSRKAENKYAGGNPVCVRPTPKWQKGIGEFFRLSPKDSEKENQIPEEAGSSGLGKAKRKACPLQPDHTNDEKE
Target-Kategorie: PCLAF
Application Verdünnung: Lyophilized from a 0.22 µm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.
Anwendungsbeschreibung: ResearchArea: Other Recombinant Protein. Shipping: Ice Bag
Recombinant Human PCLAF Protein was determined by SDS-PAGE under reducing conditions with Coomassie Blue.