Recombinant Human PCLAF Protein

Catalog Number: ABB-RP03162
Article Name: Recombinant Human PCLAF Protein
Biozol Catalog Number: ABB-RP03162
Supplier Catalog Number: RP03162
Alternative Catalog Number: ABB-RP03162-50UG
Manufacturer: ABclonal
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Human
Immunogen: Met1-Glu111
Alternative Names: PCLAF, KIAA0101, NS5ATP9, PAF
Recombinant Human PCLAF Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Met1-Glu111) of Human PCLAF (Accession NP_055551.1) fused with a polyhistide tag at the N-terminus.
Concentration: Please contact us for more information.
Molecular Weight: 13.8 KDa.
Tag: N-His
NCBI: 9768
UniProt: Q15004
Source: E. coli
Purity: 95 % as determined by SDS-PAGE.
Form: Lyophilized from a 0.22 µm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.
Sequence: MVRTKADSVPGTYRKVVAARAPRKVLGSSTSATNSTSVSSRKAENKYAGGNPVCVRPTPKWQKGIGEFFRLSPKDSEKENQIPEEAGSSGLGKAKRKACPLQPDHTNDEKE
Target: PCLAF
Application Dilute: Lyophilized from a 0.22 µm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.
Application Notes: ResearchArea: Other Recombinant Protein. Shipping: Ice Bag
Recombinant Human PCLAF Protein was determined by SDS-PAGE under reducing conditions with Coomassie Blue.