Recombinant Human Aminoacylase 1/ACY 1 Protein

Artikelnummer: ABB-RP03197
Artikelname: Recombinant Human Aminoacylase 1/ACY 1 Protein
Artikelnummer: ABB-RP03197
Hersteller Artikelnummer: RP03197
Alternativnummer: ABB-RP03197-50UG
Hersteller: ABclonal
Wirt: Virus
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Immunogen: Met 1-Ser 408
Alternative Synonym: ACY1,Aminoacylase-1, ACY-1, 3.5.1.14, N-acyl-L-amino-acid amidohydrolase
Recombinant Human Aminoacylase 1/ACY 1 Protein is produced by Baculovirus-Insect Cells expression system. The target protein is expressed with sequence (Met1-Ser408) of Human Aminoacylase 1/ACY 1 (Accession NP_000657.1) fused with a His tag at the C-terminus.
Konzentration: < 1 EU/µg of the protein by LAL method.
Molekulargewicht: 47.3 kDa
Tag: C-His
NCBI: 95
UniProt: Q03154
Quelle: Baculovirus-Insect Cells
Reinheit: 95 % as determined by SDS-PAGE.
Formulierung: Lyophilized from sterile 50mM Tris, 100mM NaCl, pH 8.0, 10% glycerol
Sequenz: MTSKGPEEEHPSVTLFRQYLRIRTVQPKPDYGAAVAFFEETARQLGLGCQKVEVAPGYVVTVLTWPGTNPTLSSILLNSHTDVVPVFKEHWSHDPFEAFKDSEGYIYARGAQDMKCVSIQYLEAVRRLKVEGHRFPRTIHMTFVPDEEVGGHQGMELFVQRPEFHALRAGFALDEGIANPTDAFTVFYSERSPWWVRVTSTGRPGHASRFMEDTAAEKLHKVVNSILAFREKEWQRLQSNPHLKEGSVTSVNLTK
Target-Kategorie: Aminoacylase 1
Application Verdünnung: Lyophilized from sterile 50mM Tris, 100mM NaCl, pH 8.0, 10% glycerol
Anwendungsbeschreibung: ResearchArea: Other Recombinant Protein. Shipping: Ice Bag
Recombinant Human Aminoacylase 1/ACY 1 Protein was determined by SDS-PAGE under reducing conditions with Coomassie Blue.