Recombinant Human Aminoacylase 1/ACY 1 Protein

Catalog Number: ABB-RP03197
Article Name: Recombinant Human Aminoacylase 1/ACY 1 Protein
Biozol Catalog Number: ABB-RP03197
Supplier Catalog Number: RP03197
Alternative Catalog Number: ABB-RP03197-50UG
Manufacturer: ABclonal
Host: Virus
Category: Proteine/Peptide
Species Reactivity: Human
Immunogen: Met 1-Ser 408
Alternative Names: ACY1,Aminoacylase-1, ACY-1, 3.5.1.14, N-acyl-L-amino-acid amidohydrolase
Recombinant Human Aminoacylase 1/ACY 1 Protein is produced by Baculovirus-Insect Cells expression system. The target protein is expressed with sequence (Met1-Ser408) of Human Aminoacylase 1/ACY 1 (Accession NP_000657.1) fused with a His tag at the C-terminus.
Concentration: < 1 EU/µg of the protein by LAL method.
Molecular Weight: 47.3 kDa
Tag: C-His
NCBI: 95
UniProt: Q03154
Source: Baculovirus-Insect Cells
Purity: 95 % as determined by SDS-PAGE.
Form: Lyophilized from sterile 50mM Tris, 100mM NaCl, pH 8.0, 10% glycerol
Sequence: MTSKGPEEEHPSVTLFRQYLRIRTVQPKPDYGAAVAFFEETARQLGLGCQKVEVAPGYVVTVLTWPGTNPTLSSILLNSHTDVVPVFKEHWSHDPFEAFKDSEGYIYARGAQDMKCVSIQYLEAVRRLKVEGHRFPRTIHMTFVPDEEVGGHQGMELFVQRPEFHALRAGFALDEGIANPTDAFTVFYSERSPWWVRVTSTGRPGHASRFMEDTAAEKLHKVVNSILAFREKEWQRLQSNPHLKEGSVTSVNLTK
Target: Aminoacylase 1
Application Dilute: Lyophilized from sterile 50mM Tris, 100mM NaCl, pH 8.0, 10% glycerol
Application Notes: ResearchArea: Other Recombinant Protein. Shipping: Ice Bag
Recombinant Human Aminoacylase 1/ACY 1 Protein was determined by SDS-PAGE under reducing conditions with Coomassie Blue.