Recombinant Human Dihydropyrimidinase/DPYS Protein

Artikelnummer: ABB-RP03199
Artikelname: Recombinant Human Dihydropyrimidinase/DPYS Protein
Artikelnummer: ABB-RP03199
Hersteller Artikelnummer: RP03199
Alternativnummer: ABB-RP03199-100UG
Hersteller: ABclonal
Wirt: Virus
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Immunogen: Met1-Pro519
Alternative Synonym: DHP, DHPase, DPYS
Recombinant Human Dihydropyrimidinase/DPYS Protein is produced by Baculovirus-Insect Cells expression system. The target protein is expressed with sequence (Met1-Pro519) of Human Dihydropyrimidinase/DPYS (Accession Q14117) fused with two additional amino acids (Gly&Pro) at the N-terminus.
Konzentration: < 1 EU/µg of the protein by LAL method.
Molekulargewicht: 56.8 kDa
Tag: No tag
NCBI: 1807
UniProt: Q14117
Quelle: Baculovirus-Insect Cells
Reinheit: 95 % as determined by SDS-PAGE.
Formulierung: Lyophilized from sterile 20 mM Tris, 500 mM NaCl, 3 mM DTT, 10% glycerol, pH 8.0. Please contact us for any concerns or special requirements. Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween80 are added as protectants before lyophilization.
Sequenz: MAAPSRLLIRGGRVVNDDFSEVADVLVEDGVVRALGHDLLPPGGAPAGLRVLDAAGKLVLPGGIDTHTHMQFPFMGSRSIDDFHQGTKAALSGGTTMIIDFAIPQKGGSLIEAFETWRSWADPKVCCDYSLHVAVTWWSDQVKEEMKILVQDKGVNSFKMFMAYKDLYMVTDLELYEAFSRCKEIGAIAQVHAENGDLIAEGAKKMLALGITGPEGHELCRPEAVEAEATLRAITIASAVNCPLYIVHVMSKSAA
Target-Kategorie: DPYS
Application Verdünnung: Lyophilized from sterile 20 mM Tris, 500 mM NaCl, 3 mM DTT, 10% glycerol, pH 8.0. Please contact us for any concerns or special requirements. Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween80 are added as protectants before lyophilization.
Anwendungsbeschreibung: ResearchArea: Other Recombinant Protein. Shipping: Ice Bag
Recombinant Human Dihydropyrimidinase/DPYS Protein was determined by SDS-PAGE under reducing conditions with Coomassie Blue.