Recombinant Human Dihydropyrimidinase/DPYS Protein

Catalog Number: ABB-RP03199
Article Name: Recombinant Human Dihydropyrimidinase/DPYS Protein
Biozol Catalog Number: ABB-RP03199
Supplier Catalog Number: RP03199
Alternative Catalog Number: ABB-RP03199-100UG
Manufacturer: ABclonal
Host: Virus
Category: Proteine/Peptide
Species Reactivity: Human
Immunogen: Met1-Pro519
Alternative Names: DHP, DHPase, DPYS
Recombinant Human Dihydropyrimidinase/DPYS Protein is produced by Baculovirus-Insect Cells expression system. The target protein is expressed with sequence (Met1-Pro519) of Human Dihydropyrimidinase/DPYS (Accession Q14117) fused with two additional amino acids (Gly&Pro) at the N-terminus.
Concentration: < 1 EU/µg of the protein by LAL method.
Molecular Weight: 56.8 kDa
Tag: No tag
NCBI: 1807
UniProt: Q14117
Source: Baculovirus-Insect Cells
Purity: 95 % as determined by SDS-PAGE.
Form: Lyophilized from sterile 20 mM Tris, 500 mM NaCl, 3 mM DTT, 10% glycerol, pH 8.0. Please contact us for any concerns or special requirements. Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween80 are added as protectants before lyophilization.
Sequence: MAAPSRLLIRGGRVVNDDFSEVADVLVEDGVVRALGHDLLPPGGAPAGLRVLDAAGKLVLPGGIDTHTHMQFPFMGSRSIDDFHQGTKAALSGGTTMIIDFAIPQKGGSLIEAFETWRSWADPKVCCDYSLHVAVTWWSDQVKEEMKILVQDKGVNSFKMFMAYKDLYMVTDLELYEAFSRCKEIGAIAQVHAENGDLIAEGAKKMLALGITGPEGHELCRPEAVEAEATLRAITIASAVNCPLYIVHVMSKSAA
Target: DPYS
Application Dilute: Lyophilized from sterile 20 mM Tris, 500 mM NaCl, 3 mM DTT, 10% glycerol, pH 8.0. Please contact us for any concerns or special requirements. Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween80 are added as protectants before lyophilization.
Application Notes: ResearchArea: Other Recombinant Protein. Shipping: Ice Bag
Recombinant Human Dihydropyrimidinase/DPYS Protein was determined by SDS-PAGE under reducing conditions with Coomassie Blue.