Recombinant Human Leukotriene A4 Hydrolase Protein

Artikelnummer: ABB-RP03209
Artikelname: Recombinant Human Leukotriene A4 Hydrolase Protein
Artikelnummer: ABB-RP03209
Hersteller Artikelnummer: RP03209
Alternativnummer: ABB-RP03209-50UG
Hersteller: ABclonal
Wirt: Virus
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Immunogen: Met1-Asp611
Alternative Synonym: Leukotriene A-4 hydrolase, LTA-4 hydrolase, Leukotriene A(4) hydrolase, Tripeptide aminopeptidase LTA4H
Recombinant Human Leukotriene A4 Hydrolase Protein is produced by Baculovirus-Insect Cells expression system. The target protein is expressed with sequence (Met1-Asp611) of human Leukotriene A4 Hydrolase (Accession NP_000886.1) fused with His tag at the C-terminus.
Konzentration: < 1 EU/µg of the protein by LAL method.
Molekulargewicht: 70.7 kDa
Tag: C-His
NCBI: 4048
UniProt: P09960
Quelle: Baculovirus-Insect Cells
Reinheit: 95 % as determined by SDS-PAGE. 95 % as determined by HPLC.
Formulierung: Lyophilized from a 0.22 µm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.
Sequenz: MPEIVDTCSLASPASVCRTKHLHLRCSVDFTRRTLTGTAALTVQSQEDNLRSLVLDTKDLTIEKVVINGQEVKYALGERQSYKGSPMEISLPIALSKNQEIVIEISFETSPKSSALQWLTPEQTSGKEHPYLFSQCQAIHCRAILPCQDTPSVKLTYTAEVSVPKELVALMSAIRDGETPDPEDPSRKIYKFIQKVPIPCYLIALVVGALESRQIGPRTLVWSEKEQVEKSAYEFSETESMLKIAEDLGGPYVWG
Target-Kategorie: LTA4H
Application Verdünnung: Lyophilized from a 0.22 µm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.
Anwendungsbeschreibung: ResearchArea: Other Recombinant Protein. Shipping: Ice Bag
Recombinant Human Leukotriene A4 Hydrolase Protein was determined by SDS-PAGE under reducing conditions with Coomassie Blue.