Recombinant Human Leukotriene A4 Hydrolase Protein

Catalog Number: ABB-RP03209
Article Name: Recombinant Human Leukotriene A4 Hydrolase Protein
Biozol Catalog Number: ABB-RP03209
Supplier Catalog Number: RP03209
Alternative Catalog Number: ABB-RP03209-50UG
Manufacturer: ABclonal
Host: Virus
Category: Proteine/Peptide
Species Reactivity: Human
Immunogen: Met1-Asp611
Alternative Names: Leukotriene A-4 hydrolase, LTA-4 hydrolase, Leukotriene A(4) hydrolase, Tripeptide aminopeptidase LTA4H
Recombinant Human Leukotriene A4 Hydrolase Protein is produced by Baculovirus-Insect Cells expression system. The target protein is expressed with sequence (Met1-Asp611) of human Leukotriene A4 Hydrolase (Accession NP_000886.1) fused with His tag at the C-terminus.
Concentration: < 1 EU/µg of the protein by LAL method.
Molecular Weight: 70.7 kDa
Tag: C-His
NCBI: 4048
UniProt: P09960
Source: Baculovirus-Insect Cells
Purity: 95 % as determined by SDS-PAGE. 95 % as determined by HPLC.
Form: Lyophilized from a 0.22 µm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.
Sequence: MPEIVDTCSLASPASVCRTKHLHLRCSVDFTRRTLTGTAALTVQSQEDNLRSLVLDTKDLTIEKVVINGQEVKYALGERQSYKGSPMEISLPIALSKNQEIVIEISFETSPKSSALQWLTPEQTSGKEHPYLFSQCQAIHCRAILPCQDTPSVKLTYTAEVSVPKELVALMSAIRDGETPDPEDPSRKIYKFIQKVPIPCYLIALVVGALESRQIGPRTLVWSEKEQVEKSAYEFSETESMLKIAEDLGGPYVWG
Target: LTA4H
Application Dilute: Lyophilized from a 0.22 µm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.
Application Notes: ResearchArea: Other Recombinant Protein. Shipping: Ice Bag
Recombinant Human Leukotriene A4 Hydrolase Protein was determined by SDS-PAGE under reducing conditions with Coomassie Blue.