Recombinant Human REG3G Protein

Artikelnummer: ABB-RP03255
Artikelname: Recombinant Human REG3G Protein
Artikelnummer: ABB-RP03255
Hersteller Artikelnummer: RP03255
Alternativnummer: ABB-RP03255-50UG
Hersteller: ABclonal
Wirt: Human
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Immunogen: Met1-Asp175
Alternative Synonym: Regenerating islet-derived protein 3-gamma, REG-3-gamma, REG3G, Pancreatitis-associated protein 1B, PAP1B
Recombinant Human REG3G Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Met1-Asp175) of human REG3G (Accession Q6UW15) fused with His tag at the C-terminus.
Konzentration: < 1 EU/µg of the protein by LAL method.
Molekulargewicht: 18 kDa
Tag: C-His
NCBI: 130120
UniProt: Q6UW15
Quelle: HEK293 cells
Reinheit: 95 % as determined by SDS-PAGE.
Formulierung: Lyophilized from a 0.22 µm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.
Sequenz: MLPPMALPSVSWMLLSCLILLCQVQGEETQKELPSPRISCPKGSKAYGSPCYALFLSPKSWMDADLACQKRPSGKLVSVLSGAEGSFVSSLVRSISNSYSYIWIGLHDPTQGSEPDGDGWEWSSTDVMNYFAWEKNPSTILNPGHCGSLSRSTGFLKWKDYNCDAKLPYVCKFKD
Target-Kategorie: REG3G
Application Verdünnung: Lyophilized from a 0.22 µm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.
Anwendungsbeschreibung: ResearchArea: Other Recombinant Protein. Shipping: Ice Bag
Recombinant Human REG3G Protein was determined by SDS-PAGE under reducing conditions with Coomassie Blue.