Recombinant Human REG3G Protein

Catalog Number: ABB-RP03255
Article Name: Recombinant Human REG3G Protein
Biozol Catalog Number: ABB-RP03255
Supplier Catalog Number: RP03255
Alternative Catalog Number: ABB-RP03255-50UG
Manufacturer: ABclonal
Host: Human
Category: Proteine/Peptide
Species Reactivity: Human
Immunogen: Met1-Asp175
Alternative Names: Regenerating islet-derived protein 3-gamma, REG-3-gamma, REG3G, Pancreatitis-associated protein 1B, PAP1B
Recombinant Human REG3G Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Met1-Asp175) of human REG3G (Accession Q6UW15) fused with His tag at the C-terminus.
Concentration: < 1 EU/µg of the protein by LAL method.
Molecular Weight: 18 kDa
Tag: C-His
NCBI: 130120
UniProt: Q6UW15
Source: HEK293 cells
Purity: 95 % as determined by SDS-PAGE.
Form: Lyophilized from a 0.22 µm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.
Sequence: MLPPMALPSVSWMLLSCLILLCQVQGEETQKELPSPRISCPKGSKAYGSPCYALFLSPKSWMDADLACQKRPSGKLVSVLSGAEGSFVSSLVRSISNSYSYIWIGLHDPTQGSEPDGDGWEWSSTDVMNYFAWEKNPSTILNPGHCGSLSRSTGFLKWKDYNCDAKLPYVCKFKD
Target: REG3G
Application Dilute: Lyophilized from a 0.22 µm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.
Application Notes: ResearchArea: Other Recombinant Protein. Shipping: Ice Bag
Recombinant Human REG3G Protein was determined by SDS-PAGE under reducing conditions with Coomassie Blue.