Recombinant Canine CXCL12/SDF-1 Protein

Artikelnummer: ABB-RP03263
Artikelname: Recombinant Canine CXCL12/SDF-1 Protein
Artikelnummer: ABB-RP03263
Hersteller Artikelnummer: RP03263
Alternativnummer: ABB-RP03263-50UG
Hersteller: ABclonal
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Canine
Immunogen: Lys22-Met93
Alternative Synonym: Stromal cell-derived factor 1, SDF-1, C-X-C motif chemokine 12, CXCL12
Recombinant Canine CXCL12/SDF-1 Protein is produced by E. coli expression system. The target protein is expressed with sequence(Lys22-Met93) of Canine CXCL12/SDF-1 (Accession NP_001121569.1) fused with No tag.
Konzentration: Please contact us for more information.
Molekulargewicht: 8.6 kDa
Tag: No tag
NCBI: 449622
UniProt: Q3LSL4
Quelle: E.coli
Reinheit: 95 % as determined by SDS-PAGE.
Formulierung: Lyophilized from a 0.22 µm filtered solution of 50 mM Tris, 500 mM NaCl, pH 8.0. Contact us for customized product form or formulation.
Sequenz: KPVSLSYRCPCRFFESHIARANVKHLKILNTPNCALQIVARLKNNSRQVCIDPKLKWIQEYLEKALNKRFKM
Target-Kategorie: CXCL12
Application Verdünnung: Lyophilized from a 0.22 µm filtered solution of 50 mM Tris, 500 mM NaCl, pH 8.0. Contact us for customized product form or formulation.
Anwendungsbeschreibung: ResearchArea: Cytokines & Cytokine receptors. Shipping: Ice Bag
Recombinant Canine CXCL12/SDF-1 Protein was determined by SDS-PAGE under reducing conditions with Coomassie Blue.