Recombinant Canine CXCL12/SDF-1 Protein

Catalog Number: ABB-RP03263
Article Name: Recombinant Canine CXCL12/SDF-1 Protein
Biozol Catalog Number: ABB-RP03263
Supplier Catalog Number: RP03263
Alternative Catalog Number: ABB-RP03263-50UG
Manufacturer: ABclonal
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Canine
Immunogen: Lys22-Met93
Alternative Names: Stromal cell-derived factor 1, SDF-1, C-X-C motif chemokine 12, CXCL12
Recombinant Canine CXCL12/SDF-1 Protein is produced by E. coli expression system. The target protein is expressed with sequence(Lys22-Met93) of Canine CXCL12/SDF-1 (Accession NP_001121569.1) fused with No tag.
Concentration: Please contact us for more information.
Molecular Weight: 8.6 kDa
Tag: No tag
NCBI: 449622
UniProt: Q3LSL4
Source: E.coli
Purity: 95 % as determined by SDS-PAGE.
Form: Lyophilized from a 0.22 µm filtered solution of 50 mM Tris, 500 mM NaCl, pH 8.0. Contact us for customized product form or formulation.
Sequence: KPVSLSYRCPCRFFESHIARANVKHLKILNTPNCALQIVARLKNNSRQVCIDPKLKWIQEYLEKALNKRFKM
Target: CXCL12
Application Dilute: Lyophilized from a 0.22 µm filtered solution of 50 mM Tris, 500 mM NaCl, pH 8.0. Contact us for customized product form or formulation.
Application Notes: ResearchArea: Cytokines & Cytokine receptors. Shipping: Ice Bag
Recombinant Canine CXCL12/SDF-1 Protein was determined by SDS-PAGE under reducing conditions with Coomassie Blue.