Recombinant Staphylococcus aureus Protein A Protein

Artikelnummer: ABB-RPT0019

Artikelname:	Recombinant Staphylococcus aureus Protein A Protein
Artikelnummer:	ABB-RPT0019
Hersteller Artikelnummer:	RPT0019
Alternativnummer:	ABB-RPT0019-10MG
Hersteller:	ABclonal
Wirt:	E. coli
Kategorie:	Proteine/Peptide
Spezies Reaktivität:	Bacteria
Alternative Synonym:	Staphylococcal Protein A,SPA,IgG-binding protein A,Immunoglobulin G-binding protein A

Recombinant Staphylococcus aureus Protein A is produced by E. coli expression system.

Konzentration:	Please contact us for more information.
NCBI:	3919448
UniProt:	P02976
Quelle:	E. coli
Reinheit:	90 % as determined by SDS-PAGE.
Formulierung:	It is recommended that sterile water (500µL) be added to the vial to prepare a stock solution of 20.00 mg/mL. Concentration is measured by BCA. It is recommended that the protein be aliquoted and be used as soon as possible. Avoid repeated freeze-thaw cyc
Sequenz:	MHHHHHHAQHDEAQQNAFYQVLNMPNLNADQRNGFIQSLKDDPSQSANVLGEAQKLNDSQAPKADAQQVNFNKDQQSAFYEILNMPNLNEAQRNGFIQSLKDDPSQSTNVLGEAKKLNESSAPKADNNFNKEQQNAFYEILNMPNLNEEQRNGFIQSLKDDPSQSANLLSEAKKLNESQAPKASNKFNKEQQNAFYEILHLPNLNEEQRNGFIQSLKDDPSQSANLLAEAKKLVDAQAPKADNKFNKEQQNAFYE
Target-Kategorie:	Protein A

Application Verdünnung:	It is recommended that sterile water (500µL) be added to the vial to prepare a stock solution of 20.00 mg/mL. Concentration is measured by BCA. It is recommended that the protein be aliquoted and be used as soon as possible. Avoid repeated freeze-thaw cyc
Anwendungsbeschreibung:	ResearchArea: Tool proteins. Shipping: Ice Bag

Recombinant Staphylococcus aureus Protein A Protein was determined by SDS-PAGE under reducing conditions with Coomassie Blue.

* Mehrwertsteuer und Versandkosten nicht enthalten.
Irrtümer und Preisänderungen vorbehalten