Recombinant Staphylococcus aureus Protein A Protein

Catalog Number: ABB-RPT0019

Article Name:	Recombinant Staphylococcus aureus Protein A Protein
Biozol Catalog Number:	ABB-RPT0019
Supplier Catalog Number:	RPT0019
Alternative Catalog Number:	ABB-RPT0019-10MG
Manufacturer:	ABclonal
Host:	E. coli
Category:	Proteine/Peptide
Species Reactivity:	Bacteria
Alternative Names:	Staphylococcal Protein A,SPA,IgG-binding protein A,Immunoglobulin G-binding protein A

Recombinant Staphylococcus aureus Protein A is produced by E. coli expression system.

Concentration:	Please contact us for more information.
NCBI:	3919448
UniProt:	P02976
Source:	E. coli
Purity:	90 % as determined by SDS-PAGE.
Form:	It is recommended that sterile water (500µL) be added to the vial to prepare a stock solution of 20.00 mg/mL. Concentration is measured by BCA. It is recommended that the protein be aliquoted and be used as soon as possible. Avoid repeated freeze-thaw cyc
Sequence:	MHHHHHHAQHDEAQQNAFYQVLNMPNLNADQRNGFIQSLKDDPSQSANVLGEAQKLNDSQAPKADAQQVNFNKDQQSAFYEILNMPNLNEAQRNGFIQSLKDDPSQSTNVLGEAKKLNESSAPKADNNFNKEQQNAFYEILNMPNLNEEQRNGFIQSLKDDPSQSANLLSEAKKLNESQAPKASNKFNKEQQNAFYEILHLPNLNEEQRNGFIQSLKDDPSQSANLLAEAKKLVDAQAPKADNKFNKEQQNAFYE
Target:	Protein A

Application Dilute:	It is recommended that sterile water (500µL) be added to the vial to prepare a stock solution of 20.00 mg/mL. Concentration is measured by BCA. It is recommended that the protein be aliquoted and be used as soon as possible. Avoid repeated freeze-thaw cyc
Application Notes:	ResearchArea: Tool proteins. Shipping: Ice Bag

Recombinant Staphylococcus aureus Protein A Protein was determined by SDS-PAGE under reducing conditions with Coomassie Blue.

* VAT and and shipping costs not included.
Errors and price changes excepted