Monoclonal Antibody to DOG-1 / TMEM16A / ANO1 (Gastrointestinal Stromal Tumor Marker)(Clone : DOG-1.1), Clone: [DOG-1.1], Mouse

Artikelnummer: ABI-36-1581
Artikelname: Monoclonal Antibody to DOG-1 / TMEM16A / ANO1 (Gastrointestinal Stromal Tumor Marker)(Clone : DOG-1.1), Clone: [DOG-1.1], Mouse
Artikelnummer: ABI-36-1581
Hersteller Artikelnummer: 36-1581
Alternativnummer: ABI-36-1581-100UG
Hersteller: Abeomics
Wirt: Mouse
Kategorie: Antikörper
Applikation: IHC
Spezies Reaktivität: Human
Immunogen: A synthetic peptide from human DOG-1 protein (MSDFVDWVIPDIPKDISQQIHKEKVLMVELFMREEQDKQQL-LETCMEKERQKDEPPCNHHNTKACPDSLGSPAPSHAYHGGVL), conjugated to a carrier protein.
Alternative Synonym: ANO1||DOG1||ORAOV2||TAOS2||TMEM16A
Expression of DOG-1 protein is elevated in the gastrointestinal stromal tumors (GISTs), c-kit signaling-driven mesenchymal tumors of the GI tract. DOG-1 is rarely expressed in other soft tissue tumors, which, due to appearance, may be difficult to diagnose. Immunoreactivity for DOG-1 has been reported in 97.8 percent of scorable GISTs, including all c-kit negative GISTs. Overexpression of DOG-1 has been suggested to aid in the identification of GISTs, including Platelet-Derived Growth Factor Receptor Alpha mutants that fail to express c-kit antigen. The overall sensitivity of DOG1 and c-kit in GISTs is nearly identical: 94.4% vs. 94.7%.
Klonalität: Monoclonal
Klon-Bezeichnung: [DOG-1.1]
NCBI: 55107
UniProt: Q5XXA6
Reinheit: Affinity Chromatography
Formulierung: Purified
Target-Kategorie: DOG-1 / TMEM16A / ANO1 (Gastrointestinal Stromal Tumor Marker)
Application Verdünnung: Immunohistology (Formalin-fixed) (1-2ug/ml for 30 minutes at RT),(Staining of formalin-fixed tissues requires boiling tissue sections in 10mM citrate buffer, pH 6.0, for 10-20 min followed by cooling at RT for 20 minutes),