Monoclonal Antibody to DOG-1 / TMEM16A / ANO1 (Gastrointestinal Stromal Tumor Marker)(Clone : DOG-1.1), Clone: [DOG-1.1], Mouse

Catalog Number: ABI-36-1581
Article Name: Monoclonal Antibody to DOG-1 / TMEM16A / ANO1 (Gastrointestinal Stromal Tumor Marker)(Clone : DOG-1.1), Clone: [DOG-1.1], Mouse
Biozol Catalog Number: ABI-36-1581
Supplier Catalog Number: 36-1581
Alternative Catalog Number: ABI-36-1581-100UG
Manufacturer: Abeomics
Host: Mouse
Category: Antikörper
Application: IHC
Species Reactivity: Human
Immunogen: A synthetic peptide from human DOG-1 protein (MSDFVDWVIPDIPKDISQQIHKEKVLMVELFMREEQDKQQL-LETCMEKERQKDEPPCNHHNTKACPDSLGSPAPSHAYHGGVL), conjugated to a carrier protein.
Alternative Names: ANO1||DOG1||ORAOV2||TAOS2||TMEM16A
Expression of DOG-1 protein is elevated in the gastrointestinal stromal tumors (GISTs), c-kit signaling-driven mesenchymal tumors of the GI tract. DOG-1 is rarely expressed in other soft tissue tumors, which, due to appearance, may be difficult to diagnose. Immunoreactivity for DOG-1 has been reported in 97.8 percent of scorable GISTs, including all c-kit negative GISTs. Overexpression of DOG-1 has been suggested to aid in the identification of GISTs, including Platelet-Derived Growth Factor Receptor Alpha mutants that fail to express c-kit antigen. The overall sensitivity of DOG1 and c-kit in GISTs is nearly identical: 94.4% vs. 94.7%.
Clonality: Monoclonal
Clone Designation: [DOG-1.1]
NCBI: 55107
UniProt: Q5XXA6
Purity: Affinity Chromatography
Form: Purified
Target: DOG-1 / TMEM16A / ANO1 (Gastrointestinal Stromal Tumor Marker)
Application Dilute: Immunohistology (Formalin-fixed) (1-2ug/ml for 30 minutes at RT),(Staining of formalin-fixed tissues requires boiling tissue sections in 10mM citrate buffer, pH 6.0, for 10-20 min followed by cooling at RT for 20 minutes),