Anti-HLA-DQB1 Picoband Antibody, Rabbit, Polyclonal
Artikelnummer:
ABT-ABO10019
| Artikelname: |
Anti-HLA-DQB1 Picoband Antibody, Rabbit, Polyclonal |
| Artikelnummer: |
ABT-ABO10019 |
| Hersteller Artikelnummer: |
ABO10019 |
| Alternativnummer: |
ABT-ABO10019-100UG |
| Hersteller: |
Abcepta |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Spezies Reaktivität: |
Human |
| Immunogen: |
A synthetic peptide corresponding to a sequence of human HLA-DQB1 (DAEYWNSQKEVLERTRAELDTVCRHNYQLELRTTLQRR). |
| Rabbit IgG polyclonal antibody for HLA-DQB1 detection. Tested with WB in Human. |
| Klonalität: |
Polyclonal |
| UniProt: |
A00106-1 |
| Formulierung: |
Lyophilized |
| Antibody Type: |
Polyclonal Antibody |
| Anwendungsbeschreibung: |
Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
