Anti-HLA-DQB1 Picoband Antibody, Rabbit, Polyclonal
Catalog Number:
ABT-ABO10019
| Article Name: |
Anti-HLA-DQB1 Picoband Antibody, Rabbit, Polyclonal |
| Biozol Catalog Number: |
ABT-ABO10019 |
| Supplier Catalog Number: |
ABO10019 |
| Alternative Catalog Number: |
ABT-ABO10019-100UG |
| Manufacturer: |
Abcepta |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Species Reactivity: |
Human |
| Immunogen: |
A synthetic peptide corresponding to a sequence of human HLA-DQB1 (DAEYWNSQKEVLERTRAELDTVCRHNYQLELRTTLQRR). |
| Rabbit IgG polyclonal antibody for HLA-DQB1 detection. Tested with WB in Human. |
| Clonality: |
Polyclonal |
| UniProt: |
A00106-1 |
| Form: |
Lyophilized |
| Antibody Type: |
Polyclonal Antibody |
| Application Notes: |
Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
