Anti-Leptin Receptor Antibody, Rabbit, Polyclonal

Artikelnummer: ABT-ABO10063
Artikelname: Anti-Leptin Receptor Antibody, Rabbit, Polyclonal
Artikelnummer: ABT-ABO10063
Hersteller Artikelnummer: ABO10063
Alternativnummer: ABT-ABO10063-100UG
Hersteller: Abcepta
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, IHC-P
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Leptin Receptor (793-839aa KKYYIHDHFIPIEKYQFSLYPIFMEGVGKPKIINSFTQDDIEKHQSD), different from the related mouse sequence by nine amino acids, and from the related rat sequence by eig
Alternative Synonym: Leptin receptor, LEP-R, HuB219, OB receptor, OB-R, CD295, LEPR, DB, OBR
Rabbit IgG polyclonal antibody for Leptin receptor(LEPR) detection. Tested with IHC-P, ELISA in Human,Mouse,Rat.
Klonalität: Polyclonal
Konzentration: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Molekulargewicht: 132494
NCBI: 3953
UniProt: P48357
Formulierung: Lyophilized
Antibody Type: Polyclonal Antibody
Anwendungsbeschreibung: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.