Anti-Leptin Receptor Antibody, Rabbit, Polyclonal

Catalog Number: ABT-ABO10063
Article Name: Anti-Leptin Receptor Antibody, Rabbit, Polyclonal
Biozol Catalog Number: ABT-ABO10063
Supplier Catalog Number: ABO10063
Alternative Catalog Number: ABT-ABO10063-100UG
Manufacturer: Abcepta
Host: Rabbit
Category: Antikörper
Application: ELISA, IHC-P
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Leptin Receptor (793-839aa KKYYIHDHFIPIEKYQFSLYPIFMEGVGKPKIINSFTQDDIEKHQSD), different from the related mouse sequence by nine amino acids, and from the related rat sequence by eig
Alternative Names: Leptin receptor, LEP-R, HuB219, OB receptor, OB-R, CD295, LEPR, DB, OBR
Rabbit IgG polyclonal antibody for Leptin receptor(LEPR) detection. Tested with IHC-P, ELISA in Human,Mouse,Rat.
Clonality: Polyclonal
Concentration: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Molecular Weight: 132494
NCBI: 3953
UniProt: P48357
Form: Lyophilized
Antibody Type: Polyclonal Antibody
Application Notes: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.