Anti-PAX8 Picoband Antibody, Rabbit, Polyclonal
Artikelnummer:
ABT-ABO10128
| Artikelname: |
Anti-PAX8 Picoband Antibody, Rabbit, Polyclonal |
| Artikelnummer: |
ABT-ABO10128 |
| Hersteller Artikelnummer: |
ABO10128 |
| Alternativnummer: |
ABT-ABO10128-100UG |
| Hersteller: |
Abcepta |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Spezies Reaktivität: |
Human, Mouse, Rat |
| Immunogen: |
A synthetic peptide corresponding to a sequence of human PAX8 (RKHLRTDAFSQHHLEPLECPFERQHYPEAYASPSHTKGEQ). |
| Alternative Synonym: |
Paired box protein Pax-8, PAX8 |
| Rabbit IgG polyclonal antibody for PAX8 detection. Tested with WB in Human,Mouse,Rat. |
| Klonalität: |
Polyclonal |
| Molekulargewicht: |
48218 |
| NCBI: |
7849 |
| UniProt: |
Q06710 |
| Formulierung: |
Lyophilized |
| Antibody Type: |
Polyclonal Antibody |
| Anwendungsbeschreibung: |
Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
