Anti-PAX8 Picoband Antibody, Rabbit, Polyclonal
Catalog Number:
ABT-ABO10128
| Article Name: |
Anti-PAX8 Picoband Antibody, Rabbit, Polyclonal |
| Biozol Catalog Number: |
ABT-ABO10128 |
| Supplier Catalog Number: |
ABO10128 |
| Alternative Catalog Number: |
ABT-ABO10128-100UG |
| Manufacturer: |
Abcepta |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Species Reactivity: |
Human, Mouse, Rat |
| Immunogen: |
A synthetic peptide corresponding to a sequence of human PAX8 (RKHLRTDAFSQHHLEPLECPFERQHYPEAYASPSHTKGEQ). |
| Alternative Names: |
Paired box protein Pax-8, PAX8 |
| Rabbit IgG polyclonal antibody for PAX8 detection. Tested with WB in Human,Mouse,Rat. |
| Clonality: |
Polyclonal |
| Molecular Weight: |
48218 |
| NCBI: |
7849 |
| UniProt: |
Q06710 |
| Form: |
Lyophilized |
| Antibody Type: |
Polyclonal Antibody |
| Application Notes: |
Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
