Anti-Tec Picoband Antibody, Rabbit, Polyclonal
Artikelnummer:
ABT-ABO10136
| Artikelname: |
Anti-Tec Picoband Antibody, Rabbit, Polyclonal |
| Artikelnummer: |
ABT-ABO10136 |
| Hersteller Artikelnummer: |
ABO10136 |
| Alternativnummer: |
ABT-ABO10136-100UG |
| Hersteller: |
Abcepta |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Spezies Reaktivität: |
Human, Mouse, Rat |
| Immunogen: |
A synthetic peptide corresponding to a sequence of human Tec (HDANTLYIFAPSPQSRDLWVKKLKEEIKNNNNIMIKYHPK). |
| Alternative Synonym: |
Tyrosine-protein kinase Tec, 2.7.10.2, TEC, PSCTK4 |
| Rabbit IgG polyclonal antibody for Tec detection. Tested with WB in Human,Mouse,Rat. |
| Klonalität: |
Polyclonal |
| Molekulargewicht: |
73581 |
| NCBI: |
7006 |
| UniProt: |
P42680 |
| Formulierung: |
Lyophilized |
| Antibody Type: |
Polyclonal Antibody |
| Anwendungsbeschreibung: |
Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
