Anti-Tec Picoband Antibody, Rabbit, Polyclonal

Catalog Number: ABT-ABO10136
Article Name: Anti-Tec Picoband Antibody, Rabbit, Polyclonal
Biozol Catalog Number: ABT-ABO10136
Supplier Catalog Number: ABO10136
Alternative Catalog Number: ABT-ABO10136-100UG
Manufacturer: Abcepta
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence of human Tec (HDANTLYIFAPSPQSRDLWVKKLKEEIKNNNNIMIKYHPK).
Alternative Names: Tyrosine-protein kinase Tec, 2.7.10.2, TEC, PSCTK4
Rabbit IgG polyclonal antibody for Tec detection. Tested with WB in Human,Mouse,Rat.
Clonality: Polyclonal
Molecular Weight: 73581
NCBI: 7006
UniProt: P42680
Form: Lyophilized
Antibody Type: Polyclonal Antibody
Application Notes: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.