ERBB3 Antibody

Artikelnummer: ASB-ARP30252_P050
Artikelname: ERBB3 Antibody
Artikelnummer: ASB-ARP30252_P050
Hersteller Artikelnummer: ARP30252_P050
Alternativnummer: ASB-ARP30252_P050-25UL,ASB-ARP30252_P050-100UL
Hersteller: Aviva
Wirt: Rabbit
Kategorie: Proteine/Peptide
Applikation: IHC
Spezies Reaktivität: Bovine, Equine, Guinea pig, Human, Mouse, Rat
Immunogen: The immunogen is a synthetic peptide directed towards the following sequence GLLFSLARGSEVGNSQAVCPGTLNGLSVTGDAENQYQTLYKLYERCEVVM
Alternative Synonym: HER3, FERLK, LCCS2, ErbB-3, c-erbB3, erbB3-S, MDA-BF-1, c-erbB-3, p180-ErbB3, p45-sErbB3, p85-sErbB3
This gene encodes a member of the epidermal growth factor receptor (EGFR) family of receptor tyrosine kinases. This membrane-bound protein has a neuregulin binding domain but not an active kinase domain. It therefore can bind this ligand but not convey the signal into the cell through protein phosphorylation. However, it does form heterodimers with other EGF receptor family members which do have kinase activity. Heterodimerization leads to the activation of pathways which lead to cell proliferation or differentiation. Amplification of this gene and/or overexpression of its protein have been reported in numerous cancers, including prostate, bladder, and breast tumors. Alternate transcriptional splice variants encoding different isoforms have been characterized. One isoform lacks the intermembrane region and is secreted outside the cell. This form acts to modulate the activity of the membrane-bound form. Additional splice variants have also been reported, but they have not been thoroughly characterized.
Klonalität: Polyclonal
Konzentration: 0.5 mg/ml
Molekulargewicht: 148 kDa
NCBI: 2065
UniProt: P21860
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.