ERBB3 Antibody

Catalog Number: ASB-ARP30252_P050
Article Name: ERBB3 Antibody
Biozol Catalog Number: ASB-ARP30252_P050
Supplier Catalog Number: ARP30252_P050
Alternative Catalog Number: ASB-ARP30252_P050-25UL,ASB-ARP30252_P050-100UL
Manufacturer: Aviva
Host: Rabbit
Category: Proteine/Peptide
Application: IHC
Species Reactivity: Bovine, Equine, Guinea pig, Human, Mouse, Rat
Immunogen: The immunogen is a synthetic peptide directed towards the following sequence GLLFSLARGSEVGNSQAVCPGTLNGLSVTGDAENQYQTLYKLYERCEVVM
Alternative Names: HER3, FERLK, LCCS2, ErbB-3, c-erbB3, erbB3-S, MDA-BF-1, c-erbB-3, p180-ErbB3, p45-sErbB3, p85-sErbB3
This gene encodes a member of the epidermal growth factor receptor (EGFR) family of receptor tyrosine kinases. This membrane-bound protein has a neuregulin binding domain but not an active kinase domain. It therefore can bind this ligand but not convey the signal into the cell through protein phosphorylation. However, it does form heterodimers with other EGF receptor family members which do have kinase activity. Heterodimerization leads to the activation of pathways which lead to cell proliferation or differentiation. Amplification of this gene and/or overexpression of its protein have been reported in numerous cancers, including prostate, bladder, and breast tumors. Alternate transcriptional splice variants encoding different isoforms have been characterized. One isoform lacks the intermembrane region and is secreted outside the cell. This form acts to modulate the activity of the membrane-bound form. Additional splice variants have also been reported, but they have not been thoroughly characterized.
Clonality: Polyclonal
Concentration: 0.5 mg/ml
Molecular Weight: 148 kDa
NCBI: 2065
UniProt: P21860
Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.