PLAC8 Antibody
Artikelnummer:
ASB-ARP47959_P050
- Bilder (3)
| Artikelname: | PLAC8 Antibody |
| Artikelnummer: | ASB-ARP47959_P050 |
| Hersteller Artikelnummer: | ARP47959_P050 |
| Alternativnummer: | ASB-ARP47959_P050-25UL,ASB-ARP47959_P050-100UL |
| Hersteller: | Aviva |
| Wirt: | Rabbit |
| Kategorie: | Proteine/Peptide |
| Applikation: | IHC |
| Spezies Reaktivität: | Bovine, Human |
| Immunogen: | The immunogen is a synthetic peptide directed towards the following sequence AQAPVVVVTQPGVGPGPAPQNSNWQTGMCDCFSDCGVCLCGTFCFPCLGC |
| Alternative Synonym: | C15, DGIC, onzin, PNAS-144 |
|
|
Rabbit Anti-PLAC8 antibody Catalog Number: ARP47959 Formalin Fixed Paraffin Embedded Tissue: Human Spleen Primary antibody Concentration: 1:100 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1:200 Magnification: 20x Exposure Time: 0.5-2.0sec |
|
|
25 ug of the indicated Human whole cell extracts was loaded onto a 10-20% SDS-PAGE gel. 3 ug/mL of the antibody was used in this experiment. Recommended dilution for this antibody is 1-3 ug/mL. |
|
|
0 |
Produktgarantie und fachkundiger Support
