PLAC8 Antibody

Catalog Number: ASB-ARP47959_P050
Article Name: PLAC8 Antibody
Biozol Catalog Number: ASB-ARP47959_P050
Supplier Catalog Number: ARP47959_P050
Alternative Catalog Number: ASB-ARP47959_P050-25UL,ASB-ARP47959_P050-100UL
Manufacturer: Aviva
Host: Rabbit
Category: Proteine/Peptide
Application: IHC
Species Reactivity: Bovine, Human
Immunogen: The immunogen is a synthetic peptide directed towards the following sequence AQAPVVVVTQPGVGPGPAPQNSNWQTGMCDCFSDCGVCLCGTFCFPCLGC
Alternative Names: C15, DGIC, onzin, PNAS-144
Clonality: Polyclonal
Concentration: 0.5 mg/ml
Molecular Weight: 13 kDa
NCBI: 51316
UniProt: Q9NZF1
Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Rabbit Anti-PLAC8 antibody
Catalog Number: ARP47959
Formalin Fixed Paraffin Embedded Tissue: Human Spleen
Primary antibody Concentration: 1:100
Secondary Antibody: Donkey anti-Rabbit-Cy3
Secondary Antibody Concentration: 1:200
Magnification: 20x
Exposure Time: 0.5-2.0sec
25 ug of the indicated Human whole cell extracts was loaded onto a 10-20% SDS-PAGE gel. 3 ug/mL of the antibody was used in this experiment. Recommended dilution for this antibody is 1-3 ug/mL.
0


* VAT and and shipping costs not included.
Errors and price changes excepted
Availability
ORDER BY EMAIL
Product Guarantee and Expert Support
BIOZOL