LGR5 Antibody - middle region
Artikelnummer:
ASB-ARP59640_P050
- Bilder (3)
| Artikelname: | LGR5 Antibody - middle region |
| Artikelnummer: | ASB-ARP59640_P050 |
| Hersteller Artikelnummer: | ARP59640_P050 |
| Alternativnummer: | ASB-ARP59640_P050-25UL,ASB-ARP59640_P050-100UL |
| Hersteller: | Aviva |
| Wirt: | Rabbit |
| Kategorie: | Proteine/Peptide |
| Applikation: | IHC |
| Spezies Reaktivität: | Bovine, Equine, Human, Mouse, Porcine, Rabbit, Rat |
| Immunogen: | The immunogen is a synthetic peptide directed towards the following sequence KKDAGMFQAQDERDLEDFLLDFEEDLKALHSVQCSPSPGPFKPCEHLLDG |
| Alternative Synonym: | FEX, HG38, GPR49, GPR67, GRP49 |



