LGR5 Antibody - middle region

Catalog Number: ASB-ARP59640_P050
Article Name: LGR5 Antibody - middle region
Biozol Catalog Number: ASB-ARP59640_P050
Supplier Catalog Number: ARP59640_P050
Alternative Catalog Number: ASB-ARP59640_P050-25UL,ASB-ARP59640_P050-100UL
Manufacturer: Aviva
Host: Rabbit
Category: Proteine/Peptide
Application: IHC
Species Reactivity: Bovine, Equine, Human, Mouse, Porcine, Rabbit, Rat
Immunogen: The immunogen is a synthetic peptide directed towards the following sequence KKDAGMFQAQDERDLEDFLLDFEEDLKALHSVQCSPSPGPFKPCEHLLDG
Alternative Names: FEX, HG38, GPR49, GPR67, GRP49
Clonality: Polyclonal
Concentration: 0.5 mg/ml
Molecular Weight: 100 kDa
NCBI: 8549
UniProt: O75473
Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Anti-LGR5 antibody IHC of human kidney. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 10 ug/ml.
Host: Rabbit
Target Name: LGR5
Sample Tissue: Human Liver Tumor
Antibody Dilution: 0.5ug/ml
LGR5 Antibody - middle region (ARP59640_P050) in Human Liver Tumor using Western Blot